Website Research Tools

Manipur.nic.in website performance summary

Title of this websiteOfficial website of Manipur
Index page meta descriptionUnavailable

Impregnability details

Safety according to WOTUnavailable
Child Safety Rank according to WOTUnavailable
Google Safe rankingUnavailable

Ranking by Alexa

Current Alexa Global for manipur.nic.in is 933 929. The rank of manipur.nic.in has increased/decreased by +34 614 over the past 3 months

Past year ranking change
Alexa Global rating933929
Rating Delta Difference+34 614
Reach positionUnavailable
Webpage target areaUnavailable
Rank countrywideUnavailable
Alexa updated onOctober 17, 2016

Relevant ID numbers/Accounts

Adsense pub idUnavailable
Google Plus ProfileUnavailable
Google Analytics codeUnavailable
AddThis AccountUnavailable

Analysis of website server

Using 164.100.52.92, the manipur.nic.in server is hosted in IN; India; DL; National Capital Territory of Delhi; New Delhi; Asia/Kolkata; 28.60000000; 77.20000000.

Website server is located inIndia, National Capital Territory of Delhi, New Delhi
IP of the server164.100.52.92
NS recordsUnavailable

HTTP data

HTTP/1.1 200 OK Date: Tue, 20 Jun 2017 11:54:58 GMT Last-Modified: Thu, 08 Sep 2016 07:33:01 GMT Cache-Control: max-age=86400 Content-Length: 2388 Content-Type: text/html X-Powered-By: ASP.NET Server: Microsoft-IIS/8.0 Accept-Ranges: bytes ETag: "a521c83aa39d21:0"

A look at Whois

To our knowledge, registration for domain name manipur.nic.in last updated on 0000-00-00. Registered on: 0000-00-00.

Potential ownersUnavailable
Day of domain address registration0000-00-00
Last time updated0000-00-00
Website Domain Exp. date0000-00-00

Website Domain registrar information

Not provided yet

Off-site links

Start page for the site has 1 out-going links.

Most common domain address mistypes

  1. meinipur.nic.in
  2. mnipur.nic.in
  3. mznipur.nic.in
  4. manipuur.nic.in
  5. manepur.nic.in
  6. maniper.nic.in
  7. menipur.nic.in
  8. manaipur.nic.in
  9. manopur.nic.in
  10. mwnipur.nic.in
  11. manipoor.nic.in
  12. mqnipur.nic.in
  13. mxnipur.nic.in
  14. manpiur.nic.in
  15. manipyr.nic.in
  16. msnipur.nic.in
  17. nanipur.nic.in
  18. monipur.nic.in
  19. maneipur.nic.in
  20. manipur.nic.in
  21. anipur.nic.in
  22. minipur.nic.in
  23. majipur.nic.in
  24. manpur.nic.in
  25. mmanipur.nic.in
  26. manipyour.nic.in
  27. maniur.nic.in
  28. mahipur.nic.in
  29. maniipur.nic.in
  30. manipour.nic.in
  31. mynipur.nic.in
  32. janipur.nic.in
  33. maanipur.nic.in
  34. kanipur.nic.in
  35. mainipur.nic.in
  36. manypur.nic.in
  37. mabipur.nic.in
  38. manipr.nic.in
  39. manipurr.nic.in
  40. manipu.nic.in
  41. maniupr.nic.in
  42. manippur.nic.in
  43. amnipur.nic.in
  44. mnaipur.nic.in
  45. mainpur.nic.in
  46. manupur.nic.in
  47. manipru.nic.in
  48. maipur.nic.in
  49. manipar.nic.in
  50. m4nipur.nic.in
  51. mannipur.nic.in
  52. manipor.nic.in
  53. manapur.nic.in
  54. munipur.nic.in
  55. manipir.nic.in
  56. manipjr.nic.in
  57. mahnipur.nic.in
  58. manipuir.nic.in
  59. maznipur.nic.in
  60. nmanipur.nic.in
  61. manipug.nic.in
  62. mkanipur.nic.in
  63. manipkr.nic.in
  64. mjanipur.nic.in
  65. manipyur.nic.in
  66. manlpur.nic.in
  67. maniplur.nic.in
  68. manipiur.nic.in
  69. maniopur.nic.in
  70. manipuf.nic.in
  71. manipuyr.nic.in
  72. mankipur.nic.in
  73. mawnipur.nic.in
  74. manilur.nic.in
  75. mamipur.nic.in
  76. manbipur.nic.in
  77. mwanipur.nic.in
  78. manipjur.nic.in
  79. majnipur.nic.in
  80. msanipur.nic.in
  81. mankpur.nic.in
  82. manjipur.nic.in
  83. manipukr.nic.in
  84. maxnipur.nic.in
  85. manjpur.nic.in
  86. mqanipur.nic.in
  87. manikpur.nic.in
  88. masnipur.nic.in
  89. manijpur.nic.in
  90. maniour.nic.in
  91. mnanipur.nic.in
  92. manipkur.nic.in
  93. mamnipur.nic.in
  94. mabnipur.nic.in
  95. manmipur.nic.in
  96. manlipur.nic.in
  97. mzanipur.nic.in
  98. manuipur.nic.in
  99. maniupur.nic.in
  100. manoipur.nic.in
  101. jmanipur.nic.in
  102. manilpur.nic.in
  103. manhipur.nic.in
  104. manipud.nic.in
  105. maniphr.nic.in
  106. mxanipur.nic.in
  107. maniput.nic.in
  108. kmanipur.nic.in
  109. maqnipur.nic.in
  110. manipue.nic.in
  111. manipurd.nic.in
  112. maniputr.nic.in
  113. manipujr.nic.in
  114. manipure.nic.in
  115. manipurf.nic.in
  116. manipufr.nic.in
  117. maniphur.nic.in
  118. manipurt.nic.in
  119. manipuer.nic.in
  120. manipuhr.nic.in
  121. manipudr.nic.in
  122. manipugr.nic.in
  123. manipurg.nic.in

Reports of Ranked Websites

  1. robohash.org
  2. hiawei-storage.ru
  3. celebviralnews.site
  4. bosch-pt.com.sg
  5. michaelphelpsswimspa.com
  6. dupree.pe
  7. daftarasnad.ir
  8. simple2-media.fr
  9. 4electron.com
  10. moneybit.in
  11. kingscreekplantation.com
  12. planmycash.in
  13. pabxmurahpanasonic.com
  14. fc-enisey.ru
  15. zlotoryjanie.pl
  16. mbigroup.it
  17. vvsons.com
  18. julyfourth.com
  19. photoventoux.com
  20. anime1tokyo.blogspot.com
  21. vanessashaw.com
  22. esera.org
  23. best-travel.de
  24. bikesport.dk
  25. atonerealty.in
  26. yaonea.com
  27. educationweek365.com
  28. nijissokuhou.net
  29. kh-guideline.org
  30. bezzapoya.ru
  31. vikingshop.ru
  32. expertboxing.ru
  33. laserprona.net
  34. ahojbardejov.sk
  35. virusdewasa.com
  36. makeaheadmealsforbusymoms.com
  37. love-images.co.com
  38. avtoliga.net
  39. 247salescenter.com
  40. rkizinfo.com
  41. pillowplate.com
  42. dentium.co.kr
  43. 0021.ws
  44. safi.com
  45. salamgasht.com
  46. preberi.si
  47. adriatyka.pl
  48. payamashena.ir
  49. 300ee.info
  50. step4wardmedia.com
  51. backlinkshop.ir
  52. ijbhtnet.com
  53. zov-v-ryazani.ru
  54. egregistry.eg
  55. dlyalica.ru
  56. datingstore.info
  57. finansowyninja.pl
  58. siguminet.blogspot.co.id
  59. v8-moving-pictures.com
  60. kelownahomes.ca
  61. zoom-auto-sheep.ru
  62. motoremotion.it
  63. prepaidrecharge.in
  64. greubelforsey.com
  65. medicaldoctors.com.br
  66. almoe.com
  67. normalkid.com
  68. mak-radio.ru
  69. 25liao.info
  70. app-cro128.com
  71. promoval.fr
  72. tinybluelines.com
  73. rasierwerk.de
  74. alcon-contact.jp
  75. economiainstitucional.com
  76. tvfork.com
  77. stylish-house.com
  78. sm558.net
  79. koretv.com
  80. kutahyalilar.com.tr
  81. m-istra-l.ru
  82. bet1038.com
  83. thermobestehen.de
  84. newyorkbeachferry.com
  85. advokat-bortnikov.org
  86. whrckp.com
  87. rlncenter.com
  88. descargar-dll.es
  89. scholarspage.com
  90. thebestwebtraffic.com
  91. inae.in
  92. salespex.com
  93. southparktv.net
  94. misawa-airport.co.jp
  95. greatbeachvacations.com
  96. travelandroll.com
  97. finntriathlon.fi
  98. chumbertop.blogspot.com
  99. numerologyacademy.com
  100. 7blue13.mybigcommerce.com
  101. kailupetidekpoik7omfookvan.pw
  102. adwokatwszczecinie.pl
  103. mxdhaimao.com
  104. allrule.co.kr
  105. omranmaterial.ir
  106. compedia.jp
  107. deaconillustrated.com
  108. findanewlover.com
  109. foris.co.jp
  110. earn-fast.co
  111. crowdfundnation.com
  112. 360cesu.com
  113. rivalo75.com
  114. ichangjia.com
  115. gasgrilladvice.com
  116. leonstorm.com
  117. tabonline.ir
  118. stazama-zdravlja.com
  119. trailnest.com
  120. nwmeters.com
  121. nbafinals.com.br
  122. josinyxb.tmall.com
  123. hakuchi.jp
  124. si-rd.com
  125. unifod.eu
  126. pepsi.co
  127. heretyk.org
  128. salzburgresearch.at
  129. slammes.com
  130. epathology.org.cn
  131. ingic.com
  132. bahissiteleri.work
  133. mnevkusno.ru
  134. ecdl.org.ro
  135. vingoo.us
  136. wearetv.com
  137. artofsword.com
  138. ddalddali.com
  139. actividadesdeinfantilyprimaria.com
  140. abiofarm.com
  141. anime-ikemen-sengoku.jp
  142. pikkle.com