Website Research Tools

Preberi.si website performance summary

Title of this websitepreberi.si - Domov
Index page meta descriptionPreberi.si - novice na učinkovit in pregleden način, Hrpeljsko-kozinski svetniki se strinjajo, da občina od Agrarne skupnosti Draga odkupi 12.500 kvadratnih metrov zazidljivega zemljišča ob Bazoviški cesti v bližini hotela Admiral, kjer bi mlade..., Da izolska bolnišnica (SBI) ob urgentnem centru nujno potrebuje heliodrom - prostor za pristajanje helikopterja nujne medicinske pomoči, se tudi zdravstveno ministrstvo zaveda že dobro leto. A se..., Med najbolj iskanimi osebnostmi v nogometnem svetu je bil v zadnjih dneh zagotovo tudi predsednik NK Ankaran Sebastjan Dvojmoč, saj je glede novega nogometnega prvoligaša še precej neznank., Odprta kuhna, kulinarična tržnica z jedmi z vsega sveta, ki se je po slovenskih mestih dobro prijela, je v Kopru okrnjena. Tretjino Carpacciovega trga, kjer so gostinci enkrat mesečno postavili..., “Jaz nisem Hoxhaj, jaz sem Imeri. Nisem vedel, kdo so ti ljudje. Imam pet restavracij in ne potrebujem droge,” je 44-letni Besim Imeri iz Pirana včeraj odločno zatrdil, da je nedolžen. Za..., Pica velja za hitro hrano in običajno jo najdemo na seznamu hrane, ki naj bi se ji izogibali. Toda ocena tega, koliko je v resnici zdrava, je odvisna od številnih dejavnikov – vrste testa,..., »Družbene in okoljske koristi trajnostne politike lahko nastanejo le iz sinergije med trajnostnim prometnim sistemom, trajnostno gradnjo, trajnostno infrastrukturo, trajnostnim energetskim...

Impregnability details

Safety according to WOTUnavailable
Child Safety Rank according to WOTUnavailable
Google Safe rankingUnavailable

Ranking by Alexa

Current Alexa Global for preberi.si is 326 400. The rank of preberi.si has increased/decreased by +217 404 over the past 3 months

Past year ranking change
Alexa Global rating326400
Rating Delta Difference+217 404
Reach positionUnavailable
Webpage target areaUnavailable
Rank countrywideUnavailable
Alexa updated onJune 17, 2018

Relevant ID numbers/Accounts

Adsense pub idUnavailable
Google Plus ProfileUnavailable
Google Analytics code1021566-5
AddThis AccountUnavailable

Analysis of website server

Using 104.27.152.176, the preberi.si server is hosted in US; United States; CA; California; San Francisco; 94107; America/Los_Angeles; 37.76970000; -122.39330000; 807.

Website server is located inUnited States, California, San Francisco, 94107
IP of the server104.27.152.176
NS records
  • mia.ns.cloudflare.com
    173.245.58.200
    United States, California, San Francisco
  • guss.ns.cloudflare.com
    173.245.59.172
    United States, California, San Francisco

HTTP data

Set-Cookie: __utmz=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Last-Modified: Tue, 27 Jun 2017 04:18:30 GMT CF-RAY: 37559a4792d826fc-FRA Content-Type: text/html; charset=UTF-8 Set-Cookie: _ga=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Vary: Accept-Encoding Date: Tue, 27 Jun 2017 04:18:30 GMT Server: cloudflare-nginx Set-Cookie: __utma=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si HTTP/1.1 200 OK Transfer-Encoding: chunked Set-Cookie: __utmd=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Connection: keep-alive Set-Cookie: __cfduid=d18553733f4c10bca1fc42de1102fa5001498537109; expires=Wed, 27-Jun-18 04:18:29 GMT; path=/; domain=.preberi.si; HttpOnly Set-Cookie: __utmc=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Set-Cookie: __utmb=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Set-Cookie: __utmv=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=.preberi.si Cache-Control: no-store, no-cache, must-revalidate Set-Cookie: ca99e34326febef35d205e06b0f68859=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=www.preberi.si Set-Cookie: c4baf3bf6b8d3182d9e7ac81feeaefee=deleted; expires=Thu, 01-Jan-1970 00:00:01 GMT; path=/; domain=www.preberi.si

A look at Whois

To our knowledge, registration for domain name preberi.si last updated on 0000-00-00. Registered on: April 4, 2005.

Potential ownersUnavailable
Day of domain address registrationApril 4, 2005
Last time updated0000-00-00
Website Domain Exp. dateApril 4, 2018

Website Domain registrar information

domain: preberi.si registrar: DHH.si d.o.o. registrar-url: http://www.dhh.si/ nameserver: guss.ns.cloudflare.com nameserver: mia.ns.cloudflare.com registrant: G653814 status: ok created: 2005-04-04 expire: 2018-04-04 source: ARNES Domain holder: NOT DISCLOSED Tech: NOT DISCLOSED

Off-site links

Start page for the site has 1 out-going links.

Reports of Ranked Websites

  1. atonerealty.in
  2. mbigroup.it
  3. allrule.co.kr
  4. ahojbardejov.sk
  5. vanessashaw.com
  6. backlinkshop.ir
  7. avtoliga.net
  8. julyfourth.com
  9. bikesport.dk
  10. app-cro128.com
  11. zov-v-ryazani.ru
  12. zoom-auto-sheep.ru
  13. deaconillustrated.com
  14. advokat-bortnikov.org
  15. kh-guideline.org
  16. earn-fast.co
  17. prepaidrecharge.in
  18. salamgasht.com
  19. esera.org
  20. 4electron.com
  21. moneybit.in
  22. safi.com
  23. luolai.cn
  24. celebviralnews.site
  25. fc-enisey.ru
  26. daftarasnad.ir
  27. love-images.co.com
  28. inae.in
  29. vvsons.com
  30. vikingshop.ru
  31. rkizinfo.com
  32. datingstore.info
  33. pillowplate.com
  34. omranmaterial.ir
  35. egregistry.eg
  36. hiawei-storage.ru
  37. kelownahomes.ca
  38. nijissokuhou.net
  39. planmycash.in
  40. best-travel.de
  41. thebestwebtraffic.com
  42. expertboxing.ru
  43. economiainstitucional.com
  44. almoe.com
  45. m-istra-l.ru
  46. payamashena.ir
  47. alcon-contact.jp
  48. pabxmurahpanasonic.com
  49. 247salescenter.com
  50. laserprona.net
  51. adriatyka.pl
  52. bosch-pt.com.sg
  53. educationweek365.com
  54. 0021.ws
  55. dentium.co.kr
  56. landoftalk.com
  57. manipur.nic.in
  58. koretv.com
  59. yaonea.com
  60. ezzatbaroudi.wordpress.com
  61. niesmann-bischoff.com
  62. ijbhtnet.com
  63. ativaishna.com
  64. michaelphelpsswimspa.com
  65. tvfork.com
  66. dosenekonomi.com
  67. misawa-airport.co.jp
  68. mxdhaimao.com
  69. kutahyalilar.com.tr
  70. livhigh.azurewebsites.net
  71. finansowyninja.pl
  72. newyorkbeachferry.com
  73. step4wardmedia.com
  74. giftingway.com
  75. laaps.net
  76. anime1tokyo.blogspot.com
  77. dupree.pe
  78. greatbeachvacations.com
  79. greubelforsey.com
  80. robohash.org
  81. misoline.com
  82. findanewlover.com
  83. southparktv.net
  84. virusdewasa.com
  85. desktop-info.site
  86. dlyalica.ru
  87. finntriathlon.fi
  88. simple2-media.fr
  89. v8-moving-pictures.com
  90. viralinkz.com
  91. oldadmiral.livejournal.com
  92. bet1038.com
  93. motoremotion.it
  94. kingscreekplantation.com
  95. whrckp.com
  96. descargar-dll.es
  97. bezzapoya.ru
  98. foris.co.jp
  99. stylish-house.com
  100. rasierwerk.de
  101. makeaheadmealsforbusymoms.com
  102. compedia.jp
  103. kailupetidekpoik7omfookvan.pw
  104. androcode.es
  105. saintjames.com.br
  106. photoventoux.com
  107. systemaryabko.com
  108. 300ee.info
  109. zlotoryjanie.pl
  110. knockinfotech.com
  111. abiofarm.com
  112. thermobestehen.de
  113. si-rd.com
  114. ddalddali.com
  115. promoval.fr
  116. rlncenter.com
  117. salzburgresearch.at
  118. siguminet.blogspot.co.id
  119. sm558.net
  120. actividadesdeinfantilyprimaria.com
  121. heretyk.org
  122. gasgrilladvice.com
  123. chumbertop.blogspot.com
  124. travelandroll.com
  125. mak-radio.ru
  126. anime-ikemen-sengoku.jp
  127. 25liao.info
  128. salespex.com
  129. hakuchi.jp
  130. scholarspage.com
  131. normalkid.com
  132. ingic.com
  133. stazama-zdravlja.com
  134. leonstorm.com
  135. unifod.eu
  136. pikkle.com
  137. epathology.org.cn
  138. 7blue13.mybigcommerce.com
  139. numerologyacademy.com
  140. tinybluelines.com
  141. medicaldoctors.com.br
  142. adwokatwszczecinie.pl